COPE Media Kit


Cope Home
Previous entry:
RNA polymerase II-associated protein 3
Next entry:
RNA polymerase III subunit C9
Random entry:
DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS
Search COPE:

RNA polymerase III

[DNA-directed RNA polymerase III] abbr. PolIII. This enzyme is a multisubunit complex responsible for the transcription of small, untranslated RNAs, e.g., structural or catalytic RNAs such as 5S rRNA, tRNAs, Alu RNA, U6 snRNA, class III genes (Schramm and Hernandez, 2002; Geiduscheck and Kassavetis, 2001; Huang and Maraia, 2001).

Chiu et al (2009) have identified RNA polymerase III as a cytosolic DNA sensor that is instrumental in inducing IFN-beta expression. Inhibition of RNA polymerase III prevents IFN-beta induction by transfection of DNA or infection with DNA viruses. Inhibition of RNA polymerase III also abrogates IFN-beta ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=44160