RNA polymerase II-associated protein 3 |
RNA polymerase III subunit C9 |
DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS |
||
[DNA-directed RNA polymerase III] abbr. PolIII. This enzyme is a multisubunit complex responsible for the transcription of small, untranslated RNAs, e.g., structural or catalytic RNAs such as 5S rRNA, tRNAs, Alu RNA, U6 snRNA, class III genes (Schramm and Hernandez, 2002; Geiduscheck and Kassavetis, 2001; Huang and Maraia, 2001).
Chiu et al (2009) have identified RNA polymerase III as a cytosolic DNA sensor that is instrumental in inducing IFN-beta expression. Inhibition of RNA polymerase III prevents IFN-beta induction by transfection of DNA or infection with DNA viruses. Inhibition of RNA polymerase III also abrogates IFN-beta
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |