rat O-acetyl ganglioside synthase |
Rattusin |
CGGKVGKACCVPTKLSPISVLYK |
||
Rattin from rat is a peptide of 38 amino acids (MAKRGFNCLLLSISEIDLPVKRLESPNKTRRPYGASIY) showing 73% identity in the conserved region to Humanin. Significant expression is seen in the central nervous system and in cardiac and skeletal muscle. Gottardo et al (2014) have reported expression of Rattin in the anterior pituitary of female and male adult rats as well as in pituitary tumor GH3 cells. Rattin is localized in lactotropes and somatotropes. Its expression is lower in females than in males, and is inhibited by estrogens in pituitary cells from both ovariectomized female and orquidectomized male rats. The expression of Rattin in pituitary tumor cells is not regulated by estrogens.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |