retained-intron circRNAs |
Ret finger protein |
GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
||
approved gene symbol: RTBDN. Retbindin, identified originally as an expressed sequence tag by Wistow et al (2002) is a retina-specific protein of unknown function. It is secreted by rod photoreceptor cells into the inter-photoreceptor matrix. Retbindin is localized predominantly at the interface between photoreceptors and the microvilli of retinal pigment epithelium cells, a region critical for retinal function and homeostasis. In vitro, retbindin is capable of binding riboflavin, thus implicating the protein as a metabolite carrier between the retina and the retinal pigment epithelium Kelley et al, 2015).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |