SLAAPQRFamide |
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
tufted cells |
||
This designation refers to a member of a group of lactose-binding lectins. Another designation is Lactose-binding lectin 1. The protein is being referred to also as L-14 (Barondes, 1984; Leffler et al, 1989), has been renamed L-14-I (Gitt et al, 1992), and is identical with Galectin-1, encoded by the LGALS1 [galactose-specific soluble lectin 1 gene.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |