SCYA18 |
SCYA20 |
YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF |
||
[small inducible cytokine A19] The protein belongs to the CC-Chemokines and has been described as ELC (EBI-1-Ligand Chemokine), Exodus-3, MIP-3-beta, Ck-beta-11. The approved gene symbol is CCL19. See also: SCY family of cytokines.
This factor is known mainly because of its chemotactic activity. For an unrelated function as an antimicrobial peptide in innate immunity see: CCL19. For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |