SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS |
SDKPNLEEVASFDKTKLKKTETQEKNPLPTKETIEQEKQAS |
ABS |
||
This peptide corresponds to Thymosin-beta-4. See: Thymic hormones.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |