SOX17 |
SOX25 |
MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK |
||
(approved gene symbol) [SRY box 21; sex determining region Y box 21] also: SRY-related HMG box gene 21. The mouse gene has been isolated and named by Tani et al (1997) who reported expression specifically in the brain, suggesting that may be involved in the development of the nervous system.
The human gene has been identified by Cremazy et al (1998) who referred to it as SOX25 [SRY box 25; sex determining region Y box 25]. Malas et al (1999) have cloned the human SOX21 gene. The protein is a member of a family of transcription factors named after SRY [sex-determining region Y] and contains a characteristic HMG box.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |