SPWSKCSAACGQTGVQTRTR |
SPWSPCSTSCGLGVSTRI |
GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE |
||
This bioactive peptide is from a gene (AAI01021.1) that appears to be a human counterpart of Danio rerio ism2 [isthmin-2]. See: Thrombostatin con-3.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |