stinging cells |
STIP1 homology and U-box containing protein 1 |
VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVS |
||
[Stress-induced-phosphoprotein 1] STIP1 is being referred to also as STI1 [stress-inducible protein 1]. This protein has been described independently as IEF SSP 3521 [Transformation-sensitive protein IEF SSP 3521], a protein overexpressed in transformed cells. It is the same as Hop [Hsc70/Hsp90-organizing protein; Hsp70/Hsp90-organizing protein], a protein involved in heat shock response. The protein has been identified also as a renal cell carcinoma antigen (NY-REN-11, REN-11) (Scanlan et al, 1999). The protein has been identified independently as SIC1 [Stress-Induced Chondrocytic 1].
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |