SCAIF-1 |
Scallop antimicrobial peptide |
extracellular matrix receptor-6 |
||
[Scallop antimicrobial peptide] This peptide of 39 amino acids (MSGRGKGGKVKGKAKSRSSRAGLQFPVGRIHRLLRKGNY) corresponds to a sequence from the N-terminal region of histone H2A from scallop Chlamys farreri. The recombinant peptide shows activity of an antimicrobial peptide and is active against both Gram-positive bacteria (M. luteus) and Gram-negative bacteria (Vibrio splendidus, Vibrio anguillarum and Vibrio vulnificus). The expression of histone H2A in scallop hemocytes challenged by bacteria is not upregulated after stimulation, suggesting that histone H2A does not participate directly in immune responses. For bioactive fragments of histone proteins see also: HDAPs [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |