seminal plasma sperm motility inhibitor |
seminal vesicle protein-4 |
PPTB |
||
abbr. SAP, SPLN. This peptide of 48 amino acids (SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK) (Theil and Scheit, 1983; Sitaram et al, 1986) has been isolated from bull sperm (Reddy and Bhargava, 1979). Sitaram et al (1986) have reported that Seminalplasmin is identical with caltrin, a calcium ion transport-inhibitory protein of bovine seminal plasma. The protein is known also as Peptide YY-2 (Couzens et al, 2000).
Gietzen and Galla (1985) and Comte et al (1986) have reported that Seminalplasmin is an endogenous calmodulin antagonist.
Seminalplasmin has been shown to be a transcription-inhibitory protein (Scheit et al, 1985) that acts as a DNA
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |