SgIII |
SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
UCMAa |
||
[Semenogelin-2 antimicrobial peptide A] This peptide, KQEGRDHDKSKGHFHMIVIHHKGGQAHHG, derived from the seminal plasma protein Semenogelin-2, is thought to be generated by degradation of Semenogelin-2, which itself has no antibacterial activity. The bioactive fragment shows antibacterial activity at micromolar concentrations against Streptococcus pyogenes and Escherichia coli. The activity against Escherichia coli is potentiated by Zn2+ or low pH. For bioactive fragments of parent proteins see also: cryptides.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |