Sphingosine-1-phosphate receptor 4 |
Sphistin(12-38) |
C1q and tumor necrosis factor related protein 4 |
||
This peptide of 38 amino acid (MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK) has been identified in the mud crab Scylla paramamosain by Chen et al (2015). The sequence is derived from the N-terminus of crab histone H2A. For bioactive fragments of histone proteins see also: HDAPs [Histone-derived antimicrobial peptides].
Sphistin causes leakage of cell membranes and shows high antimicrobial activity against Gram-positive, Gram-negative bacteria and yeast. Sphistin is not cytotoxic for primary cultured crab hemolymph cells and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |