Spred-1 |
sprinter |
GVFDIIKGAGKQLIARAMGKIAEKVGLNKDGN |
||
[Sprouty-related EVH1 domain-containing protein 2] The gene encoding Spred-2 (411 amino acids) has been cloned by Wakioka et al (2001) from an osteoclast cDNA library. Spred-2 is related to Sprouty. Kato et al (2003) have reported expression of Spred-2 in all mouse tissues examined. Spred-2, like the related Spred-1, has been shown to regulate differentiation in rat neuronal cells and mouse myocytes by inhibiting activation of MAP kinase in response to growth factors (Wakioka et al, 2001; Nonami et al, 2004).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |