Staphylococcus aureus Map |
Staphylococcus aureus mprF |
VTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR |
||
Map [MHC class II analog protein] This protein is secreted by Staphylococcus aureus. Map contains six repeated domains of 110 amino acids; each containing a subdomain of 30 amino acids with similarity to a sequence in the peptide-binding groove of the MHC class II beta chain of various mammals (Jönsson K et al, 1995).
Map has been shown to bind to a variety of components of the extracellular matrix, including fibronectin, fibrinogen, vitronectin, osteopontin, and thrombospondin, and to some extent collagen (McGavin et al, 1993) and serves as a bacterial adhesin. Functions other than that of a bacterial adhesin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |