TIAP |
Tiarin |
AYVLDEPKPIKDLEKSLQHNLVYCRRLVLEYFLKSIFEYH |
||
[TIA-1-related; T-cell-restricted intracellular antigen-related protein; T-cell internal antigen-1 related protein] The approved gene symbol is TIAL1 [cytotoxic granule-associated RNA binding protein-like 1]. The protein has been identified independently as TCBP [T cluster-binding protein], a protein that binds to the promoter region of the PF4 [platelet factor-4] (CXCL4) and reduces its expression (Doi et al, 1997). The cDNA encoding TIAR has been cloned
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |