TIMGLKPETRYAVR |
TIMP-1 |
QRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR |
||
[TIMPs]
[tissue inhibitor of metalloproteinases] Tissue inhibitors of metalloproteinases comprise a family of four inhibitors known as TIMP-1, TIMP-2, TIMP-3, and TIMP-4. These proteins are endogenous inhibitors of several groups of proteases, which includes secreted and membrane-bound members of the matrix metalloproteinases, as well as members of the ADAM protein family and ADAMTS protein family. Each member of the TIMP family has its own distinct profile of metalloproteinase inhibition (Chirco et al, 2006; Lambert et al, 2004: Nagase et al, 2006).
Note: in older publication the designation TIMP refers to the protein now known as
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |