THP 3 |
Thp cells |
HLA-DR-gamma |
||
[T helper cell-induced peptide 5] This factor has been identified by Khan et al (2012). Expression of Thp5 is up-regulated dramatically in CD4(+) T-cells early after cell activation. Naïve CD4(+) T-cells also produce Thp5.
The Thp5 peptide (MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG) has been shown to regulate the production of early IL4 in newly activated CD4(+) T-cells. Cytokines (IL12 and IL6 plus TGF-beta) that promote the differentiation of Th1 cells or Th17 cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |