COPE Media Kit


Cope Home
Previous entry:
worm AIF homolog 1
Next entry:
Wound healing formula
Random entry:
MSILPCKNVSIWVIKDTAASDKEVVLGSDRAIKFLYLATG
Search COPE:

Wound healing

[sites of wounding, tissue repair, tissue remodeling, tissue regeneration, tissue reorganization, wounding, wound repair]

Healing of a wound is a complex and protracted process of tissue repair and remodeling in response to injury. The wound healing response is aimed at reconstituting a tissue closely similar to the original one and can be divided into several distinct but overlapping phases. Adult an fetal wound healing is a complex process (Hantash et al, 2008) that involves the participation of many different cell types (Koh and DiPietro, 2011; Grieb et al, 2011; Velnar et al, 2009; Adamson, 2009; Keen, 2008; Gethin, 2012), and the concerted action of cytokines, growth factors, chemokines, extracellular and cell surface proteases, as well as corresponding receptors and extracellular matrix ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=54113