Y RNA-derived small RNAs |
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
PABA peptide hydrolase |
||
[Y RNA]
These small non-coding RNAs (100 ± 20 nucleotides) were discovered as components of cytoplasmic ribonucleoproteins associated with autoantigens (Ro60 and La proteins) in patients suffering from the autoimmune diseases systemic lupus erythematosus and Sjögren's syndrome (Hendrick et al, 1981; Lerner et al, 1981). These RNAs fold into characteristic stem-loop secondary structures in which the 5′ and 3′ RNA ends hybridise to form predominantly double-stranded upper and lower stem domains with an internal loop (Teunissen et al, 2000; van Gelder et al, 1994). Y RNAs are found in a variety of metazoans (Perreault et al, 2007) and are homologous in structure and function with non-coding stem-bulge RNAs (abbr. sbRNAs) in nematodes
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |