ALBP |
Albumin-1 chain b |
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL |
||
approved gene symbol: ALB. Also: serum albumin (abbr. for human serum albumin frequently also HSA, which also has other meanings). The gene structure has been reported by Minghetti et al (1986). Albumin is a globular unglycosylated serum protein of 65 kDa (Meloun et al, 1975). The term albumin A refers to the common form of Albumin. Albumin B is a variant found mainly in Europeans. Many different electrophoretic variants of serum albumin are known, and mutations in the Albumin gene result in various anomalous proteins.
Albumin comprises approximately 50 % of the blood serum
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |