bursal-derived pentapeptide-I |
Bursal hexapeptide |
QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK |
||
abbr. BPP-II. This pentapeptide (MTLTG) has been isolated from the bursa of Fabricius, the central humoral immune organ unique to birds which plays important roles in B-lymphocyte differentiation, by Feng et al, 2012).
The peptide, which is one of several other bursal peptides, has immunomodulatory functions on antibody responses in vitro. Gene microarray analyses demonstrate that most of the 2478 genes regulated by the peptide in a mouse-derived hybridoma cell line are associated with immune responses and tumor processes. Bursal-derived pentapeptide-II exhibits immunomodulatory effects on antigen-specific immune responses in vivo, including enhancement of avian
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |