CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR |
cIAP2 |
Lactotransferrin |
||
[cellular IAP1]
[cellular inhibitor of apoptosis-1] The gene for this protein has been cloned by Rothe et al (1995). The protein was identified as a TNF receptor-associated factor. It does not interact directly with the TNF receptor but associates with TRAF1 and TRAF2.
The protein has been renamed BIRC2 [baculoviral IAP repeat-containing protein-2]. See: IAP. See also: Apoptosis.
cIAP1 can directly bind to activated caspase-3 and caspase-7 and inhibit their activities (Deveraux et al, 1997; Roy et al, 1997). Mutational analysis shows that the copies of BIR domain
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |