casein-beta(178-182) |
casein-beta(191-193) |
GGVSGVSDFEPIEVFGEDYDSDEADEDGKG |
||
Also: beta-casein(184-210). This bioactive fragment of human casein-beta with the sequence QELLLNPTHQYPVTQPLAPVHNPISV is produced by hydrolysis of human sodium caseinate with a partially purified proteinase of Lactobacillus helveticus (Minervini et al, 2003). The peptide, which is resistant against further degradation by trypsin or chymotrpysin, shows antimicrobial activity and is active against a very large spectrum of Gram-positive bacteria and Gram-negative bacteria, including species of potential clinical interest, such as Enterococcus faecium, Bacillus megaterium, Escherichia coli
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |