collagen type 6 |
collagen type 6 C5 peptide |
GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR |
||
for this bioactive fragment of collagen type 6 see: Endotrophin.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |