COPE Media Kit


Cope Home
Previous entry:
erythrocyte chemokine receptor
Next entry:
erythrocyte membrane protein band 3
Random entry:
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNF
Search COPE:

erythrocyte ghosts

[erythrocyte ghost]

a term for red blood cells that have undergone hemolysis and thus do no longer contain hemoglobin (Zimmermann et al, 1975; Schneeweiss et al, 1977; Saleemuddin et al, 1997). These cells have a leaky cell membrane. Such ghost cells are observed in blood films also. The membranes can be resealed and thus have been used extensively to study biochemical membrane processes. Erythrocyte ghosts can be used as protein carriers by exposure to hypotonic solution containing the cargo proteins. These proteins can then be introduced into recipient cells by fusing the ghosts with the cells (Uchida, 1988).

The term erythrosomes or nanoerythrosomes ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: May 2015



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=17768