erythrocyte chemokine receptor |
erythrocyte membrane protein band 3 |
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNF |
||
[erythrocyte ghost]
a term for red blood cells that have undergone hemolysis and thus do no longer contain hemoglobin (Zimmermann et al, 1975; Schneeweiss et al, 1977; Saleemuddin et al, 1997). These cells have a leaky cell membrane. Such ghost cells are observed in blood films also. The membranes can be resealed and thus have been used extensively to study biochemical membrane processes. Erythrocyte ghosts can be used as protein carriers by exposure to hypotonic solution containing the cargo proteins. These proteins can then be introduced into recipient cells by fusing the ghosts with the cells (Uchida, 1988).
The term erythrosomes or nanoerythrosomes
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |