MNGCs |
mNKT-cells |
KKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPY |
||
The mouse monoclonal antibody designated mNI-11 (Ikewaki et al (1993) binds strongly to the myelomonocytic cell line, U937 and moderately to peripheral blood mononuclear cells. The antibody strongly induces homotypic cell aggregation of LPS-U937 cells. McGreal et al (2002) have reported that the target antigen recognized by this antibody is CD93.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |