NEPNP |
NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
DEAH box protein 36 |
||
Neprilysin is the designation for a thermolysin-like zinc metalloendopeptidase (see also: renal brush-border neutral proteinase) that plays an important role in turning off peptide signaling events at the cell surface (Turner et al, 2001). It is involved in the metabolism of a number of regulatory peptides of the mammalian nervous, cardiovascular, inflammatory and immune systems, including enkephalins, tachykinins, ANF, and chemotactic peptides (see also: NEP [neutral endopeptidase]. Ruchon et al (2000) have reported that osteostatin (PTHrP[107-139]), osteogenic growth peptide (
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |