PEPr |
Pep TGN |
HKNKGKKNGKHNGWKT |
||
This antimicrobial peptide, LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR, is derived from the putative RNA-binding domain of the dengue virus capsid protein (MA et al, 2004). pepR is an antimicrobial peptide that destroys the membrane of Escherichia coli. It is inactive against Gram-positive bacteria.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |