Physalaemin |
physiological DCs |
IFGSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPQT |
||
from Greek; bubbly cells. These cells are characteristic of chordomas, uncommon malignant tumors originating from remnants of the notochord. They are large cells characterized by voluminous, variably vacuolated, clear cytoplasm, with a peripheral nucleus, reflecting the notochordal cells in their late stage (Friedmann et al, 1962; Boneschi et al, 2003; Gui et al, 2994). The cell stain positive for cytokeratins, vimentin, EMA [epithelial membrane antigen], and S100 protein (Ma X et al, 2014; D'Amuri et al, 2017).
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |