ribosomal protein L7a |
ribosomal protein L13 |
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL |
||
abbr.: RPL11, L11. This protein is a component of the 60S subunit of ribosomes (60S ribosomal protein L11) (Kenmochi et al, 1998). The human cDNA has been cloned by Mishin et al (1995). The gene structure has been reported by Voronina et al (2003). Ribosomal protein L11 does not appear to be completely essential for ribosome function. Nguyen-Lefebvre et al (2014) have reported that the viral oncogene v-erbA generates ribosomes devoid of ribosomal protein L11 and regulates translational activity in avian erythroid progenitors from these ribosomes.
Role as moonlighting protein
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |