Ace-MIF |
ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT |
KIR2DL2 |
||
[Achatina cardioexcitatory peptide-1] This neuroactive peptide (SGQSWRPQGRFamide) has been isolated from the atria of the African giant snail Achatina fulica Férussac (Fujimoto et al, 1990). The peptide is present in Achatina ganglia and effective on the Achatina giant neurons. ACEP-1 also stimulates the heart muscle and also other muscles such as the penis retractor and buccal muscles (Fujimoto et al, 1990). For a closely related peptide see: LyCEP [Lymnaea cardioexcitatory peptide]
The cDNA has been cloned by Satake et al (1999). ACEP-1 mRNA is expressed in the atrium and in the central nervous system. It is found in small neurons
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |