AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL |
aEPEC |
type B kidney intercalated cells |
||
(approved gene symbol) [apoptosis-enhancing nuclease] This protein is known also as ISG20L1 [Interferon-stimulated 20 kDa exonuclease-like 1]. AEN encodes a deduced 325 amino acid protein with significant homology to various exonucleases. Expression of AEN is induced in the cause of ionizing irradiation-induced cell death by apoptosis. AEN efficiently cleaves single-stranded, blunt end double-stranded, 3-prime recessed, and branched DNA, and less efficiently cleaves nicked and 5-prime recessed DNA. AEN colocalizes with AIFM1 and CAD [caspase-activated DNAse] in the nucleus of irradiated cells and its expression acts to increase apoptosis
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |