COPE Media Kit


Cope Home
Previous entry:
AMFR
Next entry:
AMGAP
Random entry:
DGGEEQTLSTEAETWEGAGPSIQLQLQEVKGKASQFFGLM
Search COPE:

AMG 114

This compound is a hyperglycosylated analog of recombinant human erythropoietin. In preclinical studies, AMG 114 demonstrates increased potency and longer half-life than darbepoetin alfa and epoetin-alfa. Although AMG 114 appears to be well tolerated, a Phase I/II randomised study for the treatment of anaemia with concomitant chemotherapy in patients with non-myeloid malignancies was halted, in part because of modest efficacy (De Boer et al, 2011).

An increased incidence of thrombotic toxicities in Sprague-Dawley rats administered the highest dose level of AMG 114 has been shown to be due to the expression of pleiotropic cytokines as prothrombotic factors associated with AMG 114 dose level (CCL2 (MCP-1), CCL7 (MCP-3), ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: January 2014



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=2632