APP-beta |
APPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEV |
Octamer-binding protein 4 |
||
[atherosclerotic plaque-homing peptide] This targeting peptide with the sequence CRKRLDRNC has been identified by phage display library screening . The AP peptide selectively binds to atherosclerotic plaque in vivo by adhering to the IL4 receptor on endothelial cells, macrophages, and smooth muscle cells (Hong et al, 2008). The peptide is being referred to as IL4 receptor targeting peptide (AP1 peptide; CRKRLDRN) in another publication (Sarangthem V et al, 2013).
Wu et al (2010) have described the use of AP
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |