ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
acyl-CoA-binding protein |
Casper-S |
||
abbr. ASP (a term with multiple meanings). Acylation-stimulating protein is identical to C3adesArg (C3adesArg77; des-Arg-C3a) (Baldo et al, 1993), a 76 amino acid cleavage product of the N-terminus of the alpha chain of complement factor C3 modified by enzymatic cleavage of the C-terminal arginine of C3a. Acylation stimulating is generated by the interaction of adipsin (factor D) and factor B with complement factor C3 (for oveviewsee: Hugli, 1989). The protein has been isolated independently as BP1 [basic protein 1] from normal human serum
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |