Amercin |
Ames dwarf mouse |
elastin-mimetic polypeptides |
||
abbr. AOD. This antimicrobial peptide from the American oyster (Crassostrea virginica), GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS, shows strongest activity against Gram-positive bacteria (Lactococcus lactis subsp. lactis and Staphylococcus aureus) but also has significant activity against Gram-negative bacteria (Escherichia coli D31 and Vibrio parahemolyticus). It shows high sequence homology to arthropod defensins, including those from other bivalves, the mussels Mytilus edulis and Mytilus galloprovincialis (see: Mytilins).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |