ARAM motif |
Aranesp |
Cocos nucifera antimicrobial peptide 1 |
||
[Amaranthus retroflexus antimicrobial peptide] This antimicrobial peptide of 30 amino acids (AGECVQGRCPSGMCCSQFGYCGRGPKYCGR) has been isolated from seeds of amaranth (Amaranthus retroflexus). Ar-AMP has retained its biological activities although it was isolated from seeds that had lost their germination capacity and had been collected in 1967. The peptide has been shown to inhibit the growth of different fungi: Fusarium culmorium (Smith) Sacc., Helminthosporium sativum Pammel., King et Bakke, Alternaria consortiale Fr., and Botrytis cinerea Pers., and causes morphological changes in Rhizoctonia solani Kuhn at micromolar concentrations. The peptide also protects barley seedlings from H. sativum infection (Lipkin et al, 2005).
For other proteins/peptides with functions in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |