BAH domain |
BAI-2 |
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQL |
||
[brain-specific angiogenesis inhibitor-1] The approved gene symbol is ADGRB1 [Adhesion G protein-coupled receptor B1].
The gene encoding BAI-1 is expressed specifically in the brain and has been identified as a gene the expression of which is inducible by p53 (Nishimori et al, 1997). The gene encodes a seven-span transmembrane protein of 1584 amino acids considered to be a member of the secretin receptor family. BAI-1 contains five thrombospondin type 1 repeats. The protein has been identified independently as GD-AIF [glioma-derived angiogenesis inhibitory factor]. Bioactive cleavage products of BAI-1 have been identified as Vasculostatin and Vasculostatin-40.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |