Baker's yeast |
BAL |
APKWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
||
The cDNA encodes a protein of 101 amino acids with a sequence resembling BAK [BCL2 antagonist/killer; BCL2 homologous antagonist killer] and probably identical with it (Kim et al, 2004). Like many other proteins promoting cell death by apoptosis, the protein contains BH1 and BH2 domains with other pro-apoptotic proteins. BAK-like does not contain a BH3 domain.
BAK-like is expressed in a wide variety of tissues. The protein enhances apoptosis, but is not as potent as BAK. The protein is found diffusely in the cytosol of cells ands redistributes to mitochondria upon induction of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |