C33 |
C48 |
IRAK1b |
||
This peptide, SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK, is a proteolytically generated C-terminal fragment of alpha-1-antitrypsin. It corresponds to alpha-1-antitrypsin(359-394) [SERPINA1(359-394)]. C-36 peptide displays striking concentration-dependent pro-inflammatory effects on human neutrophils, including induction of neutrophil chemotaxis, adhesion, degranulation, and superoxide generation. In contrast to C-36 peptide, native and polymerised alpha-1-antitrypsin at similar and higher concentrations shows no effects on neutrophil activation.
The peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |