C-terminal peptide of alpha-1-antitrypsin with a mass of 4.7 kDa |
C-terminal PTH receptors |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
||
For this bioactive C-terminal fragment of the acute phase protein alpha-1-antitrypsin see: CAAP48.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |