CATF |
Cathelicidin |
shRNAs |
||
[cathelicidin B1] This chicken protein (PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP) belongs to the group of avian cathelicidins (Goitsuka et al, 2007). The protein is produced by mucosal M cells exclusively in the epithelium of the bursa of Fabricius. The carboxyl-terminal peptide of chicken CATH-B1 has broad antimicrobial activity against Gram-positive bacteria and Gram-negative bacteria. Chicken CATH-B1 expression is restricted to the secretory epithelial cell neighbors of the M cells (secretory enterocytes), whereas its mature peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |