CD100 receptor |
CD102 |
KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG |
||
[CD101(+), CD101(-)]
Other designations:
EWI-101 [EWI motif-containing protein 101]
IGSF2 [immunoglobulin superfamily gene 2]
The antigen is expressed on granulocytes, monocytes, macrophages, dendritic cells (Bagot et al, 1997), Langerhans cells (Bouloc et al, 2000), and T-lymphocytes after cell activation (Gouttefangeas et al, 1994).
Bagot et al (1994) have reported that CD101 expressed by skin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |