CHb-1 |
CHBL2 |
Hepatitis C virus NS4B protein |
||
This antimicrobial peptide with the sequence MLTAEDKKLIQQAWEKAASHQEEFGAEALTRMFTTYPQTKTY has been detected in the acidic extract of blood cells from chicken. The peptide is derived from chicken hemoglobin-alpha, subunit D. The peptide forms pores similar to hemocidins and has been shown to be active in micromolar concentrations against Gram-negative Escherichia coli K12 TG1.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |