cPRL |
CPS |
Calcitonin gene-related polypeptide-alpha |
||
[CHH precursor-related peptide; crustacean hyperglycemic hormone precursor-related peptide] This peptide is found to be encoded in the preprohormones belonging to the CHH [crustacean hyperglycaemic hormone] subgroup of a larger peptide family. In the preprohormone, this sequence is C-terminally flanked by the CHH. Tensen et al (1991) have isolated and sequenced CPRPs from sinus glands of the crab Carcinus maenas (RSTQGYGRMDRILAALKTSPMEPSAALAVENGTTHPLE), the crayfish Orconectes limosus, and the lobster Homarus americanus. peptide H isolated from the land crab, Cardisoma carnifex (Newcomb, 1987) is the peptide corresponding to CPRP in this species
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |