CRAM-B |
CRAMP18 |
unc-93 |
||
[cathelin-related antimicrobial peptide] CRAMP (GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ) is a murine member of a family of antimicrobial peptides known as cathelicidins. Its processing from its precursor and gene structure strongly resemble human LL-37 and is considered the mouse ortholog of this protein (Pestonjamasp et al, 2001).
The murine CRAMP gene is expressed in adult bone marrow and during embryogenesis as early as E12, the earliest stage of blood development (Gallo et al, 1997). CRAMP expression is detected also in adult testis, spleen, stomach, and intestine but not in brain, liver, heart, or skeletal muscle. Abundant expression is seen in myeloid precursors and neutrophils
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |