COPE Media Kit


Cope Home
Previous entry:
COPE on Social Networking Sites
Next entry:
COPE Reviews
Random entry:
AURA102
Search COPE:

Copeptin

Copeptin is a glycopeptide of 39 amino acids (ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY) encoded as the C-terminal part of the large precursor for vasopressin (pre-proAVP) (hence sometimes abbr. ct-proAVP [carboxyterminal-pro-AVP] (Holwerda, 1972; Smyth and Massey, 1979; De Bree and Burbach, 1998). Copeptin is encoded by exon 3 of the vasopressin precursor (Land et al, 1982; Ivell and Burbach, 1991).

Its physiological function is unknown. Copeptin may play an important role in the correct structural formation of the Arginine-vasopressin precursor, which is required for its proteolytic maturation efficiency (Barat et al, 2004).

Copeptin is highly stable ex vivo even for several days at room temperature. The determinations of copeptin plasma ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=12266