DDT |
DDX9 |
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR |
||
[DEAD (Asp-Glu-Ala-Asp) box helicase 1]
[DEAD box helicase 1; DEAD box protein 1; DEAD box 1; DEAD/H BOX 1] This protein contains a characteristic Asp-Glu-Ala-Asp (DEAD box) motif and is an RNA helicase. The cDNA has been cloned by Godbout and Squire (1993) as DBP-RB [DEAD box protein retinoblastoma], which is amplified in retinoblastoma cells.
DDX1 has been shown to associate with factors involved in 3'-end cleavage and polyadenylation of pre-mRNAs (Bléoo et al, 2001).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |