DHX36 |
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
immune-induced peptide 2 |
||
[DEXH box polypeptide 58] This is the approved gene symbol for the pattern recognition receptor LGP2. The protein contains a characteristic DEAD box motif.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |